Class a: All alpha proteins [46456] (289 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Prolactin (placental lactogen) [47278] (2 species) |
Species Sheep (Ovis aries) [TaxId:9940] [47279] (1 PDB entry) |
Domain d1f6fa_: 1f6f A: [16839] Other proteins in same PDB: d1f6fb1, d1f6fb2, d1f6fc1, d1f6fc2 |
PDB Entry: 1f6f (more details), 2.3 Å
SCOPe Domain Sequences for d1f6fa_:
Sequence, based on SEQRES records: (download)
>d1f6fa_ a.26.1.1 (A:) Prolactin (placental lactogen) {Sheep (Ovis aries) [TaxId: 9940]} aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqygqginseskvinc htssittpnskaeaintedkilfklvisllhswdeplhhavtelanskgtspalltkaqe ikekakvlvdgveviqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrds skiytylrilkcrltsc
>d1f6fa_ a.26.1.1 (A:) Prolactin (placental lactogen) {Sheep (Ovis aries) [TaxId: 9940]} aqhppycrnqpgkcqiplqslfdrattvanynsklagemvnrfdeqyvinchtssittpn skaeaintedkilfklvisllhswdeplhhavtelanpalltkaqeikekakvlvdgvev iqkrihpgeknepypvwseqssltsqdenvrrvafyrlfhclhrdsskiytylrilkcrl tsc
Timeline for d1f6fa_:
View in 3D Domains from other chains: (mouse over for more information) d1f6fb1, d1f6fb2, d1f6fc1, d1f6fc2 |