Class b: All beta proteins [48724] (174 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187333] (15 PDB entries) |
Domain d2v90f_: 2v90 F: [168386] automated match to d1g9oa_ complexed with so4 |
PDB Entry: 2v90 (more details), 2 Å
SCOPe Domain Sequences for d2v90f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v90f_ b.36.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkprclhlekgpqgfgfllreekgldgrpgqflwevdpglpakkagmqagdrlvavages veglgheetvsriqgqgscvsltvvdpeadretsv
Timeline for d2v90f_: