SCOPe 2.06: Domain d2v90e_: 2v90 E:

Lineage for d2v90e_ (2v90 E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)

8. Domain d2v90e_: 2v90 E: [168385]
   automated match to d1g9oa_
   complexed with so4

Details for d2v90e_

PDB Entry: 2v90, 2 Å

PDB Description: crystal structure of the 3rd pdz domain of intestine- and kidney- enriched pdz domain ikepp (pdzd3)

PDB Compounds: (E:) pdz domain-containing protein 3

SCOPe Domain Sequences for d2v90e_:

Sequence; same for both SEQRES and ATOM records:

>d2v90e_ b.36.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkprclhlekgpqgfgfllreekgldgrpgqflwevdpglpakkagmqagdrlvavages
veglgheetvsriqgqgscvsltvvdpeadretsv

Timeline for d2v90e_:

• d2v90e_ first appeared in SCOPe 2.01
  
• d2v90e_ appears in SCOPe 2.05
  
• d2v90e_ appears in SCOPe 2.07
  
• d2v90e_ appears in the current release, SCOPe 2.08