Lineage for d2v90e_ (2v90 E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1122537Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 1122538Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 1123002Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 1123003Protein automated matches [190436] (3 species)
    not a true protein
  7. 1123004Species Human (Homo sapiens) [TaxId:9606] [187333] (17 PDB entries)
  8. 1123025Domain d2v90e_: 2v90 E: [168385]
    automated match to d1g9oa_
    complexed with so4

Details for d2v90e_

PDB Entry: 2v90 (more details), 2 Å

PDB Description: crystal structure of the 3rd pdz domain of intestine- and kidney- enriched pdz domain ikepp (pdzd3)
PDB Compounds: (E:) pdz domain-containing protein 3

SCOPe Domain Sequences for d2v90e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v90e_ b.36.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkprclhlekgpqgfgfllreekgldgrpgqflwevdpglpakkagmqagdrlvavages
veglgheetvsriqgqgscvsltvvdpeadretsv

SCOPe Domain Coordinates for d2v90e_:

Click to download the PDB-style file with coordinates for d2v90e_.
(The format of our PDB-style files is described here.)

Timeline for d2v90e_: