Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
Protein automated matches [190470] (2 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [188040] (2 PDB entries) |
Domain d2v78c_: 2v78 C: [168371] automated match to d1wyea1 |
PDB Entry: 2v78 (more details), 2 Å
SCOPe Domain Sequences for d2v78c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v78c_ c.72.1.1 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} vdvialgepliqfnsfnpgplrfvnyfekhvagselnfciavvrnhlscsliarvgndef gkniieysraqgidtshikvdnesftgiyfiqrgypipmkselvyyrkgsagsrlspedi nenyvrnsrlvhstgitlaisdnakeavikafelaksrsldtnirpklwsslekaketil silkkydievlitdpddtkilldvtdpdeayrkykelgvkvllyklgskgaiaykdnvka fkdaykvpvedptgagdamagtfvslylqgkdieyslahgiaastlvitvrgdneltptl edaerflnefk
Timeline for d2v78c_: