Lineage for d2v78c_ (2v78 C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2154413Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2154414Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2154415Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2154537Protein automated matches [190470] (2 species)
    not a true protein
  7. 2154540Species Sulfolobus solfataricus [TaxId:2287] [188040] (2 PDB entries)
  8. 2154543Domain d2v78c_: 2v78 C: [168371]
    automated match to d1wyea1

Details for d2v78c_

PDB Entry: 2v78 (more details), 2 Å

PDB Description: crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase
PDB Compounds: (C:) fructokinase

SCOPe Domain Sequences for d2v78c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v78c_ c.72.1.1 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vdvialgepliqfnsfnpgplrfvnyfekhvagselnfciavvrnhlscsliarvgndef
gkniieysraqgidtshikvdnesftgiyfiqrgypipmkselvyyrkgsagsrlspedi
nenyvrnsrlvhstgitlaisdnakeavikafelaksrsldtnirpklwsslekaketil
silkkydievlitdpddtkilldvtdpdeayrkykelgvkvllyklgskgaiaykdnvka
fkdaykvpvedptgagdamagtfvslylqgkdieyslahgiaastlvitvrgdneltptl
edaerflnefk

SCOPe Domain Coordinates for d2v78c_:

Click to download the PDB-style file with coordinates for d2v78c_.
(The format of our PDB-style files is described here.)

Timeline for d2v78c_: