![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein Growth hormone, somatotropin [47276] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47277] (9 PDB entries) |
![]() | Domain d1hgua_: 1hgu A: [16837] |
PDB Entry: 1hgu (more details), 2.5 Å
SCOPe Domain Sequences for d1hgua_:
Sequence, based on SEQRES records: (download)
>d1hgua_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]} ptiplsrlfqnamlrahrlhqlafdtyeefeeayipkeqkysflqapqaslcfsesiptp snreqaqqksnlqllrisllliqswlepvgflrsvfanslvygasdsdvydllkdleegi qtlmgrledgsprtgqafkqtyakfdanshnddallknygllycfrkdmdkvetflrivq crsvegscg
>d1hgua_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]} ptiplsrlfqnamlrahrlhqlafdtyeefeeayipqkysflqapqaslcfsesiptpsn reqaqqksnlqllrisllliqswlepvgflrsvfanslvygasdsdvydllkdleegiqt lmgrledgsprtgqafkqtyakfdanshnddallknygllycfrkdmdkvetflrivqcr svegscg
Timeline for d1hgua_: