Lineage for d1hgua_ (1hgu A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2315782Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2315783Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2315784Family a.26.1.1: Long-chain cytokines [47267] (10 protein domains)
  6. 2315809Protein Growth hormone, somatotropin [47276] (1 species)
  7. 2315810Species Human (Homo sapiens) [TaxId:9606] [47277] (9 PDB entries)
  8. 2315819Domain d1hgua_: 1hgu A: [16837]

Details for d1hgua_

PDB Entry: 1hgu (more details), 2.5 Å

PDB Description: human growth hormone
PDB Compounds: (A:) human growth hormone

SCOPe Domain Sequences for d1hgua_:

Sequence, based on SEQRES records: (download)

>d1hgua_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]}
ptiplsrlfqnamlrahrlhqlafdtyeefeeayipkeqkysflqapqaslcfsesiptp
snreqaqqksnlqllrisllliqswlepvgflrsvfanslvygasdsdvydllkdleegi
qtlmgrledgsprtgqafkqtyakfdanshnddallknygllycfrkdmdkvetflrivq
crsvegscg

Sequence, based on observed residues (ATOM records): (download)

>d1hgua_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]}
ptiplsrlfqnamlrahrlhqlafdtyeefeeayipqkysflqapqaslcfsesiptpsn
reqaqqksnlqllrisllliqswlepvgflrsvfanslvygasdsdvydllkdleegiqt
lmgrledgsprtgqafkqtyakfdanshnddallknygllycfrkdmdkvetflrivqcr
svegscg

SCOPe Domain Coordinates for d1hgua_:

Click to download the PDB-style file with coordinates for d1hgua_.
(The format of our PDB-style files is described here.)

Timeline for d1hgua_: