SCOPe 2.01: Domain d2v78a_: 2v78 A:

Lineage for d2v78a_ (2v78 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)

6. Protein automated matches [190470] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188040] (2 PDB entries)

8. Domain d2v78a_: 2v78 A: [168369]
   automated match to d1wyea1

Details for d2v78a_

PDB Entry: 2v78, 2 Å

PDB Description: crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase

PDB Compounds: (A:) fructokinase

SCOPe Domain Sequences for d2v78a_:

Sequence; same for both SEQRES and ATOM records:

>d2v78a_ c.72.1.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
vdvialgepliqfnsfnpgplrfvnyfekhvagselnfciavvrnhlscsliarvgndef
gkniieysraqgidtshikvdnesftgiyfiqrgypipmkselvyyrkgsagsrlspedi
nenyvrnsrlvhstgitlaisdnakeavikafelaksrsldtnirpklwsslekaketil
silkkydievlitdpddtkilldvtdpdeayrkykelgvkvllyklgskgaiaykdnvka
fkdaykvpvedptgagdamagtfvslylqgkdieyslahgiaastlvitvrgdneltptl
edaerflnefk

Timeline for d2v78a_:

• d2v78a_ is new in SCOPe 2.01-stable
  
• d2v78a_ appears in SCOPe 2.02
  
• d2v78a_ appears in the current release, SCOPe 2.08