Lineage for d2v76a_ (2v76 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551068Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1551133Protein automated matches [190580] (4 species)
    not a true protein
  7. 1551136Species Human (Homo sapiens) [TaxId:9606] [188312] (3 PDB entries)
  8. 1551137Domain d2v76a_: 2v76 A: [168363]
    automated match to d1p5ta_
    complexed with edo, gol, pge, so4

Details for d2v76a_

PDB Entry: 2v76 (more details), 1.6 Å

PDB Description: crystal structure of the human dok1 ptb domain
PDB Compounds: (A:) Docking protein 1

SCOPe Domain Sequences for d2v76a_:

Sequence, based on SEQRES records: (download)

>d2v76a_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrry
grdkvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrq

Sequence, based on observed residues (ATOM records): (download)

>d2v76a_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgilepllswpytllrrygrdk
vmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrq

SCOPe Domain Coordinates for d2v76a_:

Click to download the PDB-style file with coordinates for d2v76a_.
(The format of our PDB-style files is described here.)

Timeline for d2v76a_: