| Class b: All beta proteins [48724] (176 folds) |
| Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
| Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
| Protein automated matches [190580] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188312] (3 PDB entries) |
| Domain d2v76a_: 2v76 A: [168363] automated match to d1p5ta_ complexed with edo, gol, pge, so4 |
PDB Entry: 2v76 (more details), 1.6 Å
SCOPe Domain Sequences for d2v76a_:
Sequence, based on SEQRES records: (download)
>d2v76a_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgaqsqilepllswpytllrry
grdkvmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrq
>d2v76a_ b.55.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plgsqfwvtvqrteaaercglhgsyvlrveaerltlltvgilepllswpytllrrygrdk
vmfsfeagrrcpsgpgtftfqtaqgndifqavetaihrq
Timeline for d2v76a_: