Lineage for d2v6xa_ (2v6x A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310255Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2310272Family a.7.14.0: automated matches [191520] (1 protein)
    not a true family
  6. 2310273Protein automated matches [190877] (3 species)
    not a true protein
  7. 2310274Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188239] (3 PDB entries)
  8. 2310279Domain d2v6xa_: 2v6x A: [168362]
    automated match to d1yxra1
    complexed with so4

Details for d2v6xa_

PDB Entry: 2v6x (more details), 1.98 Å

PDB Description: stractural insight into the interaction between escrt-iii and vps4
PDB Compounds: (A:) vacuolar protein sorting-associated protein 4

SCOPe Domain Sequences for d2v6xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v6xa_ a.7.14.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
shmstgdfltkgielvqkaidldtatqyeeaytayyngldylmlalkyeknpkskdlira
kfteylnraeqlkkhleseean

SCOPe Domain Coordinates for d2v6xa_:

Click to download the PDB-style file with coordinates for d2v6xa_.
(The format of our PDB-style files is described here.)

Timeline for d2v6xa_: