Lineage for d2v6ha_ (2v6h A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2753975Domain d2v6ha_: 2v6h A: [168361]
    automated match to d2avga1

Details for d2v6ha_

PDB Entry: 2v6h (more details), 1.55 Å

PDB Description: crystal structure of the c1 domain of cardiac myosin binding protein-c
PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOPe Domain Sequences for d2v6ha_:

Sequence, based on SEQRES records: (download)

>d2v6ha_ b.1.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe

Sequence, based on observed residues (ATOM records): (download)

>d2v6ha_ b.1.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagkppvvkwfkgkwvdlsskvgqhlqlhdsyd
raskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe

SCOPe Domain Coordinates for d2v6ha_:

Click to download the PDB-style file with coordinates for d2v6ha_.
(The format of our PDB-style files is described here.)

Timeline for d2v6ha_: