Lineage for d2v5va_ (2v5v A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158545Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1158546Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 1158547Protein Flavodoxin [52220] (9 species)
  7. 1158548Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries)
  8. 1158552Domain d2v5va_: 2v5v A: [168355]
    automated match to d1oboa_
    complexed with fmn, mg

Details for d2v5va_

PDB Entry: 2v5v (more details), 1.88 Å

PDB Description: w57e flavodoxin from anabaena
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2v5va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5va_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]}
akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptenig
elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw
stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d2v5va_:

Click to download the PDB-style file with coordinates for d2v5va_.
(The format of our PDB-style files is described here.)

Timeline for d2v5va_: