![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (11 species) |
![]() | Species Anabaena, pcc 7119 and 7120 [TaxId:1163] [52223] (8 PDB entries) |
![]() | Domain d2v5va_: 2v5v A: [168355] automated match to d1oboa_ complexed with fmn, mg |
PDB Entry: 2v5v (more details), 1.88 Å
SCOPe Domain Sequences for d2v5va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5va_ c.23.5.1 (A:) Flavodoxin {Anabaena, pcc 7119 and 7120 [TaxId: 1163]} akkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptenig elqsdweglyselddvdfngklvayfgtgdqigyadnfqdaigileekisqrggktvgyw stdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
Timeline for d2v5va_: