Lineage for d2v5fa_ (2v5f A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339719Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2339863Protein automated matches [190103] (5 species)
    not a true protein
  7. 2339874Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries)
  8. 2339886Domain d2v5fa_: 2v5f A: [168346]
    automated match to d1tjca_

Details for d2v5fa_

PDB Entry: 2v5f (more details), 2.03 Å

PDB Description: crystal structure of wild type peptide-binding domain of human type i collagen prolyl 4-hydroxylase.
PDB Compounds: (A:) prolyl 4-hydroxylase subunit alpha-1

SCOPe Domain Sequences for d2v5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5fa_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fltaedcfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqgd
ldkallltkklleldpehqrangnlkyfeyimakekd

SCOPe Domain Coordinates for d2v5fa_:

Click to download the PDB-style file with coordinates for d2v5fa_.
(The format of our PDB-style files is described here.)

Timeline for d2v5fa_: