Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (10 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein automated matches [190103] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186825] (13 PDB entries) |
Domain d2v5fa_: 2v5f A: [168346] automated match to d1tjca_ |
PDB Entry: 2v5f (more details), 2.03 Å
SCOPe Domain Sequences for d2v5fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5fa_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fltaedcfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqgd ldkallltkklleldpehqrangnlkyfeyimakekd
Timeline for d2v5fa_: