SCOPe 2.01: Domain d2v5fa_: 2v5f A:

Lineage for d2v5fa_ (2v5f A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein automated matches [190103] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186825] (6 PDB entries)

8. Domain d2v5fa_: 2v5f A: [168346]
   automated match to d1tjca_

Details for d2v5fa_

PDB Entry: 2v5f, 2.03 Å

PDB Description: crystal structure of wild type peptide-binding domain of human type i collagen prolyl 4-hydroxylase.

PDB Compounds: (A:) prolyl 4-hydroxylase subunit alpha-1

SCOPe Domain Sequences for d2v5fa_:

Sequence; same for both SEQRES and ATOM records:

>d2v5fa_ a.118.8.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fltaedcfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqgd
ldkallltkklleldpehqrangnlkyfeyimakekd

Timeline for d2v5fa_:

• d2v5fa_ is new in SCOPe 2.01-stable
  
• d2v5fa_ appears in SCOPe 2.02
  
• d2v5fa_ appears in the current release, SCOPe 2.08