Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Vaccinia virus copenhagen [TaxId:10249] [188639] (2 PDB entries) |
Domain d2v54b_: 2v54 B: [168343] automated match to d1e98a_ complexed with mg, pop, tyd |
PDB Entry: 2v54 (more details), 2.4 Å
SCOPe Domain Sequences for d2v54b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v54b_ c.37.1.0 (B:) automated matches {Vaccinia virus copenhagen [TaxId: 10249]} srgalivfegldksgkttqcmnimesipantikylnfpqrstvtgkmiddyltrkktynd hivnllfcanrwefasfiqeqleqgitlivdryafsgvayaaakgasmtlsksyesglpk pdlviflesgskeinrnvgeeiyedvtfqqkvlqeykkmieegdihwqiissefeedvkk eliknivieaihtvtgpvgqlwm
Timeline for d2v54b_: