| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein automated matches [190406] (22 species) not a true protein |
| Species Coral (Discosoma sp.) [TaxId:86600] [188539] (22 PDB entries) |
| Domain d2v4ec_: 2v4e C: [168334] automated match to d1g7ka_ |
PDB Entry: 2v4e (more details), 2.4 Å
SCOPe Domain Sequences for d2v4ec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4ec_ d.22.1.1 (C:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
nvikpfmrfkvhmegsvnghefeiegegegkpyegtqtaklqvtkggplpfawdilspqf
mygskvytkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgtfiyhvkfi
gvnfpsdgpvmqkktlgwepsterlyprdgvlkgeihkalklkggghylcefksiymakk
pvklpgyyyvdsklditshnedytvveqyertearhhlfl
Timeline for d2v4ec_: