Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (8 species) not a true protein |
Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries) |
Domain d2v41g_: 2v41 G: [168330] automated match to d1prxb_ complexed with bez; mutant |
PDB Entry: 2v41 (more details), 2.4 Å
SCOPe Domain Sequences for d2v41g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v41g_ c.47.1.10 (G:) automated matches {Arenicola marina [TaxId: 6344]} gitlgevfpnfeadstigklkfhdwlgnswgvlfshprdftpvsttelgrviqlegdfkk rgvklialscdnvadhkewsedvkclsgvkgdmpypiiadetrelavklgmvdpdertst gmpltcravfiigpdkklklsilypattgrnfseilrvidslqltaqkkvatpadwqpgd rcmvvpgvsaeeaktlfpnmevkavpsgkgylrytpqpks
Timeline for d2v41g_: