Lineage for d1a22a_ (1a22 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96731Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 96732Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 96733Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 96758Protein Growth hormone, somatotropin [47276] (1 species)
  7. 96759Species Human (Homo sapiens) [TaxId:9606] [47277] (8 PDB entries)
  8. 96762Domain d1a22a_: 1a22 A: [16833]
    Other proteins in same PDB: d1a22b1, d1a22b2

Details for d1a22a_

PDB Entry: 1a22 (more details), 2.6 Å

PDB Description: human growth hormone bound to single receptor

SCOP Domain Sequences for d1a22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a22a_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens)}
fptiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesipt
psnreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleer
iqtlmgrlegqifkqtyskfdtdallknygllycfrkdmdkvetflrivqcrsvegscgf

SCOP Domain Coordinates for d1a22a_:

Click to download the PDB-style file with coordinates for d1a22a_.
(The format of our PDB-style files is described here.)

Timeline for d1a22a_: