| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries) |
| Domain d2v41d_: 2v41 D: [168327] automated match to d1prxb_ complexed with bez; mutant |
PDB Entry: 2v41 (more details), 2.4 Å
SCOPe Domain Sequences for d2v41d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v41d_ c.47.1.10 (D:) automated matches {Arenicola marina [TaxId: 6344]}
gitlgevfpnfeadstigklkfhdwlgnswgvlfshprdftpvsttelgrviqlegdfkk
rgvklialscdnvadhkewsedvkclsgvkgdmpypiiadetrelavklgmvdpdertst
gmpltcravfiigpdkklklsilypattgrnfseilrvidslqltaqkkvatpadwqpgd
rcmvvpgvsaeeaktlfpnmevkavpsgkgylrytpqpks
Timeline for d2v41d_: