Lineage for d2v3bb_ (2v3b B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036509Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 3036641Protein automated matches [190785] (5 species)
    not a true protein
  7. 3036650Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188038] (1 PDB entry)
  8. 3036651Domain d2v3bb_: 2v3b B: [168323]
    automated match to d1s24a_
    complexed with fad, fe

Details for d2v3bb_

PDB Entry: 2v3b (more details), 2.45 Å

PDB Description: crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
PDB Compounds: (B:) Rubredoxin 2

SCOPe Domain Sequences for d2v3bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v3bb_ g.41.5.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mrkwqcvvcgfiydealglpeegipagtrwedipadwvcpdcgvgkidfemie

SCOPe Domain Coordinates for d2v3bb_:

Click to download the PDB-style file with coordinates for d2v3bb_.
(The format of our PDB-style files is described here.)

Timeline for d2v3bb_: