SCOP 1.59: Domain d1axia_: 1axi A:

Lineage for d1axia_ (1axi A:)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)

4. Superfamily a.26.1: 4-helical cytokines [47266] (3 families)

5. Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)

6. Protein Growth hormone, somatotropin [47276] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47277] (8 PDB entries)

8. Domain d1axia_: 1axi A: [16832]
   Other proteins in same PDB: d1axib1, d1axib2

Details for d1axia_

PDB Entry: 1axi, 2.1 Å

PDB Description: structural plasticity at the hgh:hghbp interface

SCOP Domain Sequences for d1axia_:

Sequence, based on SEQRES records:

>d1axia_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens)}
tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesiptps
nreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriq
tlmgrltdgsprtgqifkqtyskfdtnshnddallknygllycfrrdmtyvatylrivqc
rsvegscgf

Sequence, based on observed residues (ATOM records):

>d1axia_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens)}
tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpslcfsesiptpsnr
eetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriqtl
mgrltgqifkqtyskfdtallknygllycfrrdmtyvatylrivqcrsvegscgf

Timeline for d1axia_:

• d1axia_ first appeared (with stable ids) in SCOP 1.55
  
• d1axia_ appears in SCOP 1.57
  
• d1axia_ appears in SCOP 1.61
  
• d1axia_ appears in the current release, SCOPe 2.08