Lineage for d1axia_ (1axi A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46942Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 46943Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 46944Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 46969Protein Growth hormone, somatotropin [47276] (1 species)
  7. 46970Species Human (Homo sapiens) [TaxId:9606] [47277] (8 PDB entries)
  8. 46972Domain d1axia_: 1axi A: [16832]
    Other proteins in same PDB: d1axib1, d1axib2

Details for d1axia_

PDB Entry: 1axi (more details), 2.1 Å

PDB Description: structural plasticity at the hgh:hghbp interface

SCOP Domain Sequences for d1axia_:

Sequence, based on SEQRES records: (download)

>d1axia_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens)}
tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesiptps
nreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriq
tlmgrltdgsprtgqifkqtyskfdtnshnddallknygllycfrrdmtyvatylrivqc
rsvegscgf

Sequence, based on observed residues (ATOM records): (download)

>d1axia_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens)}
tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpslcfsesiptpsnr
eetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriqtl
mgrltgqifkqtyskfdtallknygllycfrrdmtyvatylrivqcrsvegscgf

SCOP Domain Coordinates for d1axia_:

Click to download the PDB-style file with coordinates for d1axia_.
(The format of our PDB-style files is described here.)

Timeline for d1axia_: