SCOPe 2.08: Domain d1axia_: 1axi A:

Lineage for d1axia_ (1axi A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Growth hormone, somatotropin [47276] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47277] (9 PDB entries)

8. Domain d1axia_: 1axi A: [16832]
   Other proteins in same PDB: d1axib1, d1axib2
   complexed with so4

Details for d1axia_

PDB Entry: 1axi, 2.1 Å

PDB Description: structural plasticity at the hgh:hghbp interface

PDB Compounds: (A:) growth hormone

SCOPe Domain Sequences for d1axia_:

Sequence, based on SEQRES records:

>d1axia_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]}
tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesiptps
nreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriq
tlmgrltdgsprtgqifkqtyskfdtnshnddallknygllycfrrdmtyvatylrivqc
rsvegscgf

Sequence, based on observed residues (ATOM records):

>d1axia_ a.26.1.1 (A:) Growth hormone, somatotropin {Human (Homo sapiens) [TaxId: 9606]}
tiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpslcfsesiptpsnr
eetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeriqtl
mgrltgqifkqtyskfdtallknygllycfrrdmtyvatylrivqcrsvegscgf

Timeline for d1axia_:

• d1axia_ first appeared (with stable ids) in SCOP 1.55
  
• d1axia_ appears in SCOPe 2.07