Lineage for d2v2la_ (2v2l A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702536Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries)
  8. 2702539Domain d2v2la_: 2v2l A: [168312]
    automated match to d1data_
    complexed with cd, gol, so4; mutant

Details for d2v2la_

PDB Entry: 2v2l (more details), 1.9 Å

PDB Description: Mutant (E53,56,57,60Q) recombinant horse spleen apoferritin cocrystallized with haemin in acidic conditions
PDB Compounds: (A:) ferritin light chain

SCOPe Domain Sequences for d2v2la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2la_ a.25.1.1 (A:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrqlaqqkrqg
aerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlk

SCOPe Domain Coordinates for d2v2la_:

Click to download the PDB-style file with coordinates for d2v2la_.
(The format of our PDB-style files is described here.)

Timeline for d2v2la_: