Lineage for d1huw__ (1huw -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.1: Long-chain cytokines [47267] (9 proteins) 
Protein Growth hormone, somatotropin [47276] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47277] (8 PDB entries) 
Domain d1huw__: 1huw - [16831]
Details for d1huw__
PDB Entry: 1huw (more details), 2 Å
PDB Description: the crystal structure of affinity-matured human growth hormone at 2 angstroms resolution
SCOP Domain Sequences for d1huw__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1huw__ a.26.1.1 (-) Growth hormone, somatotropin {Human (Homo sapiens)}
fptiplsrladnawlradrlnqlafdtyqefeeayipkeqihsfwwnpqtslcpsesipt
psnkeetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg
iqtlmgrleallknygllycfnkdmskvstylrtvqcrsvegscgf
SCOP Domain Coordinates for d1huw__:
Click to download the PDB-style file with coordinates for d1huw__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1huw__:
- d1huw__ first appeared (with stable ids) in SCOP 1.55
- d1huw__ appears in SCOP 1.57
- d1huw__ appears in SCOP 1.61
- d1huw__ appears in the current release, SCOPe 2.08, called d1huwa_
View in 3D