Lineage for d2v2ga_ (2v2g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878108Species Arenicola marina [TaxId:6344] [188412] (4 PDB entries)
  8. 2878109Domain d2v2ga_: 2v2g A: [168305]
    automated match to d1prxb_
    complexed with bez, gol; mutant

Details for d2v2ga_

PDB Entry: 2v2g (more details), 1.6 Å

PDB Description: crystal structure of the c45s mutant of the peroxiredoxin 6 of arenicola marina. monoclinic form
PDB Compounds: (A:) peroxiredoxin 6

SCOPe Domain Sequences for d2v2ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2ga_ c.47.1.10 (A:) automated matches {Arenicola marina [TaxId: 6344]}
gitlgevfpnfeadstigklkfhdwlgnswgvlfshprdftpvsttelgrviqlegdfkk
rgvklialscdnvadhkewsedvkclsgvkgdmpypiiadetrelavklgmvdpdertst
gmpltcravfiigpdkklklsilypattgrnfseilrvidslqltaqkkvatpadwqpgd
rcmvvpgvsaeeaktlfpnmevkavpsgkgylrytpqpks

SCOPe Domain Coordinates for d2v2ga_:

Click to download the PDB-style file with coordinates for d2v2ga_.
(The format of our PDB-style files is described here.)

Timeline for d2v2ga_: