Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein automated matches [190089] (8 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188305] (24 PDB entries) |
Domain d2v2ea_: 2v2e A: [168303] automated match to d1koka_ complexed with hem, isz; mutant |
PDB Entry: 2v2e (more details), 1.68 Å
SCOPe Domain Sequences for d2v2ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v2ea_ a.93.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lvhvasvekgrsyedfqkvynaialklreddeydnaigygpvlvrlawhtsgtwdkhdnt ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk rsgyegpwgaannvftnefylnllnenwklekndanneqwdsksgymmlptdysliqdpk ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
Timeline for d2v2ea_: