Lineage for d2v2da_ (2v2d A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1143365Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 1143366Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
  6. 1143367Protein Triosephosphate isomerase [51353] (21 species)
  7. 1143565Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [51357] (41 PDB entries)
  8. 1143627Domain d2v2da_: 2v2d A: [168302]
    automated match to d1ml1a_
    complexed with po4; mutant

Details for d2v2da_

PDB Entry: 2v2d (more details), 2.3 Å

PDB Description: the a178l mutation in the c-terminal hinge of the flexible loop-6 of triosephosphate isomerase (tim) induces a more closed conformation of this hinge region in dimeric and monomeric tim
PDB Compounds: (A:) triosephosphate isomerase glycosomal

SCOPe Domain Sequences for d2v2da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2da_ c.1.1.1 (A:) Triosephosphate isomerase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
skpqpiaaanwksgspdslselidlfnstsinhdvqcvvastfvhlamtkerlshpkfvi
aaqnagnadalaslkdfgvnwivlghserrwyygetneivadkvaaavasgfmviacige
tlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvltpqqaqeahal
irswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiikat
q

SCOPe Domain Coordinates for d2v2da_:

Click to download the PDB-style file with coordinates for d2v2da_.
(The format of our PDB-style files is described here.)

Timeline for d2v2da_: