![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein Leukemia inhibitory factor (LIF) [47274] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47275] (2 PDB entries) |
![]() | Domain d1a7ma_: 1a7m A: [16830] mouse-human chimera, residues 48-81 are from human sequence |
PDB Entry: 1a7m (more details)
SCOPe Domain Sequences for d1a7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a7ma_ a.26.1.1 (A:) Leukemia inhibitory factor (LIF) {Mouse (Mus musculus) [TaxId: 10090]} splpitpvnatcairhpchgnlmnqiknqlaqlngsanalfisyytaqgepfpnnldklc gpnvtdfppfhangtekaklvelyrmvaylsasltnitrdqkvlnpsavslhsklnatid vmrgllsnvlcrlcnkyrvghvdvppvpdhsdkevfqkkklgcqllgtykqvisvvvqaf
Timeline for d1a7ma_: