Lineage for d2v29b_ (2v29 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1005129Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 1005130Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (2 families) (S)
  5. 1005131Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 1005151Protein L-rhamnulose-1-phosphate aldolase [75301] (1 species)
  7. 1005152Species Escherichia coli [TaxId:562] [75302] (8 PDB entries)
  8. 1005160Domain d2v29b_: 2v29 B: [168298]
    automated match to d1gt7a_
    complexed with act, edo, zn; mutant

Details for d2v29b_

PDB Entry: 2v29 (more details), 2.03 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant k15w)
PDB Compounds: (B:) rhamnulose-1-phosphate aldolase

SCOPe Domain Sequences for d2v29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v29b_ c.74.1.1 (B:) L-rhamnulose-1-phosphate aldolase {Escherichia coli [TaxId: 562]}
mqnitqswfvqgmiwattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmkqtisreelialgkrfgvtplasalal

SCOPe Domain Coordinates for d2v29b_:

Click to download the PDB-style file with coordinates for d2v29b_.
(The format of our PDB-style files is described here.)

Timeline for d2v29b_: