Lineage for d2il6__ (2il6 -)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441656Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 441657Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 441658Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 441698Protein Interleukin-6 [47272] (2 species)
  7. 441699Species Human (Homo sapiens) [TaxId:9606] [47273] (4 PDB entries)
  8. 441703Domain d2il6__: 2il6 - [16828]

Details for d2il6__

PDB Entry: 2il6 (more details)

PDB Description: human interleukin-6, nmr, 32 structures

SCOP Domain Sequences for d2il6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2il6__ a.26.1.1 (-) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

SCOP Domain Coordinates for d2il6__:

Click to download the PDB-style file with coordinates for d2il6__.
(The format of our PDB-style files is described here.)

Timeline for d2il6__: