Lineage for d2v0rb_ (2v0r B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988138Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2988139Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2988140Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2988200Protein automated matches [190454] (2 species)
    not a true protein
  7. 2988201Species Human (Homo sapiens) [TaxId:9606] [187368] (6 PDB entries)
  8. 2988209Domain d2v0rb_: 2v0r B: [168276]
    automated match to d1vyba_
    complexed with so4

Details for d2v0rb_

PDB Entry: 2v0r (more details), 2.3 Å

PDB Description: crystal structure of a hairpin exchange variant (ltx) of the targeting line-1 retrotransposon endonuclease
PDB Compounds: (B:) ltx

SCOPe Domain Sequences for d2v0rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v0rb_ d.151.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqa
ngkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfi
kqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlh
pksteytyvrvrdghvsqskidhivgskallskckrteiitnylsdhsaiklel

SCOPe Domain Coordinates for d2v0rb_:

Click to download the PDB-style file with coordinates for d2v0rb_.
(The format of our PDB-style files is described here.)

Timeline for d2v0rb_: