SCOPe 2.05: Domain d2v09a_: 2v09 A:

Lineage for d2v09a_ (2v09 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins)

6. Protein automated matches [190784] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [188035] (5 PDB entries)

8. Domain d2v09a_: 2v09 A: [168273]
   automated match to d1uw8a_
   complexed with mn, trs; mutant

Details for d2v09a_

PDB Entry: 2v09, 1.8 Å

PDB Description: sens161-164dssn mutant of bacillus subtilis oxalate decarboxylase oxdc

PDB Compounds: (A:) oxalate decarboxylase oxdc

SCOPe Domain Sequences for d2v09a_:

Sequence; same for both SEQRES and ATOM records:

>d2v09a_ b.82.1.2 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
dipqpirgdkgatvkiprnierdrqnpdmlvppetdhgtvsnmkfsfsdthnrlekggya
revtvrelpisenlasvnmrlkpgairelhwhkeaewaymiygsarvtivdekgrsfidd
vgegdlwyfpsglphsiqaleegaefllvfddgsfdssntfqltdwlahtpkeviaanfg
vtkeeisnlpgkekyifenqlpgslkddivegpngevpypftyrlleqepieseggkvyi
adstnfkvsktiasalvtvepgamrelhwhpnthewqyyisgkarmtvfasdghartfny
qagdvgyvpfamghyvenigdeplvfleifkddhyadvslnqwlamlpetfvqahldlgk
dftdvlskekhpvvkkk

Timeline for d2v09a_:

• d2v09a_ first appeared in SCOPe 2.01
  
• d2v09a_ appears in SCOPe 2.04
  
• d2v09a_ appears in SCOPe 2.06
  
• d2v09a_ appears in the current release, SCOPe 2.08