Lineage for d1il6__ (1il6 -)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.26: 4-helical cytokines [47265] (1 superfamily) Superfamily a.26.1: 4-helical cytokines [47266] (3 families) 
Family a.26.1.1: Long-chain cytokines [47267] (9 proteins) 
Protein Interleukin-6 [47272] (2 species) Species Human (Homo sapiens) [TaxId:9606] [47273] (3 PDB entries) 
Domain d1il6__: 1il6 - [16827]
Details for d1il6__
PDB Entry: 1il6 (more details)
PDB Description: human interleukin-6, nmr, minimized average structure
SCOP Domain Sequences for d1il6__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il6__ a.26.1.1 (-) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
SCOP Domain Coordinates for d1il6__:
Click to download the PDB-style file with coordinates for d1il6__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1il6__:
- d1il6__ first appeared (with stable ids) in SCOP 1.55
- d1il6__ appears in SCOP 1.57
- d1il6__ appears in SCOP 1.61
- d1il6__ appears in the current release, SCOPe 2.08, called d1il6a_
View in 3D