Lineage for d1il6__ (1il6 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2641Fold a.26: 4-helical cytokines [47265] (1 superfamily)
  4. 2642Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
  5. 2643Family a.26.1.1: Long-chain cytokines [47267] (8 proteins)
  6. 2678Protein Interleukin-6 [47272] (1 species)
  7. 2679Species Human (Homo sapiens) [TaxId:9606] [47273] (3 PDB entries)
  8. 2681Domain d1il6__: 1il6 - [16827]

Details for d1il6__

PDB Entry: 1il6 (more details)

PDB Description: human interleukin-6, nmr, minimized average structure

SCOP Domain Sequences for d1il6__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1il6__ a.26.1.1 (-) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

SCOP Domain Coordinates for d1il6__:

Click to download the PDB-style file with coordinates for d1il6__.
(The format of our PDB-style files is described here.)

Timeline for d1il6__: