Lineage for d2uzwe_ (2uzw E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983331Species Cow (Bos taurus) [TaxId:9913] [187007] (28 PDB entries)
  8. 2983371Domain d2uzwe_: 2uzw E: [168267]
    automated match to d1apme_
    complexed with ss4

Details for d2uzwe_

PDB Entry: 2uzw (more details), 2.2 Å

PDB Description: pka structures of indazole-pyridine series of akt inhibitors
PDB Compounds: (E:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d2uzwe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzwe_ d.144.1.7 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d2uzwe_:

Click to download the PDB-style file with coordinates for d2uzwe_.
(The format of our PDB-style files is described here.)

Timeline for d2uzwe_: