Lineage for d2uzta_ (2uzt A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674012Species Cow (Bos taurus) [TaxId:9913] [187007] (27 PDB entries)
  8. 1674046Domain d2uzta_: 2uzt A: [168264]
    automated match to d1apme_
    complexed with ss3

Details for d2uzta_

PDB Entry: 2uzt (more details), 2.1 Å

PDB Description: pka structures of akt, indazole-pyridine inhibitors
PDB Compounds: (A:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d2uzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzta_ d.144.1.7 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkdgvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

SCOPe Domain Coordinates for d2uzta_:

Click to download the PDB-style file with coordinates for d2uzta_.
(The format of our PDB-style files is described here.)

Timeline for d2uzta_: