Lineage for d2uzsa1 (2uzs A:1-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803336Protein automated matches [190063] (3 species)
    not a true protein
  7. 2803342Species Human (Homo sapiens) [TaxId:9606] [187187] (8 PDB entries)
  8. 2803355Domain d2uzsa1: 2uzs A:1-117 [168263]
    Other proteins in same PDB: d2uzsa2
    automated match to d1unpa_
    complexed with 4ip; mutant

Details for d2uzsa1

PDB Entry: 2uzs (more details), 2.46 Å

PDB Description: a transforming mutation in the pleckstrin homology domain of akt1 in cancer (akt1-ph_e17k)
PDB Compounds: (A:) RAC-alpha serine/threonine-protein kinase

SCOPe Domain Sequences for d2uzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzsa1 b.55.1.1 (A:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msdvaivkegwlhkrgkyiktwrpryfllkndgtfigykerpqdvdqreaplnnfsvaqc
qlmkterprpntfiirclqwttviertfhvetpeereewttaiqtvadglkkqeeee

SCOPe Domain Coordinates for d2uzsa1:

Click to download the PDB-style file with coordinates for d2uzsa1.
(The format of our PDB-style files is described here.)

Timeline for d2uzsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2uzsa2