| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein automated matches [190234] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188037] (3 PDB entries) |
| Domain d2uzpb_: 2uzp B: [168260] automated match to d1dsya_ complexed with ca, co, edo, plp, so4 |
PDB Entry: 2uzp (more details), 2 Å
SCOPe Domain Sequences for d2uzpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzpb_ b.7.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smhterrgrlqleiraptadeihvtvgearnlipmdpnglsdpyvklklipdprnltkqk
trtvkatlnpvwnetfvfnlkpgdverrlsvevwdwdrtsrndfmgamsfgvsellkapv
dgwykllnqeegeyynvpvada
Timeline for d2uzpb_: