Lineage for d1alu__ (1alu -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 536620Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 536621Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 536622Family a.26.1.1: Long-chain cytokines [47267] (9 proteins)
  6. 536662Protein Interleukin-6 [47272] (2 species)
  7. 536663Species Human (Homo sapiens) [TaxId:9606] [47273] (4 PDB entries)
  8. 536664Domain d1alu__: 1alu - [16826]
    complexed with so4, tar

Details for d1alu__

PDB Entry: 1alu (more details), 1.9 Å

PDB Description: human interleukin-6

SCOP Domain Sequences for d1alu__:

Sequence, based on SEQRES records: (download)

>d1alu__ a.26.1.1 (-) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d1alu__ a.26.1.1 (-) Interleukin-6 {Human (Homo sapiens)}
ltsseridkqiryildgisalrketcnksnmcenlnlpkmaekdgcfqsgfneetclvki
itgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaittpdpttnasl
ltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

SCOP Domain Coordinates for d1alu__:

Click to download the PDB-style file with coordinates for d1alu__.
(The format of our PDB-style files is described here.)

Timeline for d1alu__: