Lineage for d2uzpa_ (2uzp A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045249Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2045317Protein automated matches [190234] (3 species)
    not a true protein
  7. 2045318Species Human (Homo sapiens) [TaxId:9606] [188037] (3 PDB entries)
  8. 2045319Domain d2uzpa_: 2uzp A: [168259]
    automated match to d1dsya_
    complexed with ca, co, edo, plp, so4

Details for d2uzpa_

PDB Entry: 2uzp (more details), 2 Å

PDB Description: crystal structure of the c2 domain of human protein kinase c gamma.
PDB Compounds: (A:) protein kinase c gamma type

SCOPe Domain Sequences for d2uzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uzpa_ b.7.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smhterrgrlqleiraptadeihvtvgearnlipmdpnglsdpyvklklipdprnltkqk
trtvkatlnpvwnetfvfnlkpgdverrlsvevwdwdrtsrndfmgamsfgvsellkapv
dgwykllnqeegeyynvpvada

SCOPe Domain Coordinates for d2uzpa_:

Click to download the PDB-style file with coordinates for d2uzpa_.
(The format of our PDB-style files is described here.)

Timeline for d2uzpa_: