Class b: All beta proteins [48724] (177 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
Protein automated matches [190234] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188037] (3 PDB entries) |
Domain d2uzpa_: 2uzp A: [168259] automated match to d1dsya_ complexed with ca, co, edo, plp, so4 |
PDB Entry: 2uzp (more details), 2 Å
SCOPe Domain Sequences for d2uzpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uzpa_ b.7.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} smhterrgrlqleiraptadeihvtvgearnlipmdpnglsdpyvklklipdprnltkqk trtvkatlnpvwnetfvfnlkpgdverrlsvevwdwdrtsrndfmgamsfgvsellkapv dgwykllnqeegeyynvpvada
Timeline for d2uzpa_: