SCOPe 2.05: Domain d2uzpa_: 2uzp A:

Lineage for d2uzpa_ (2uzp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein automated matches [190234] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188037] (3 PDB entries)

8. Domain d2uzpa_: 2uzp A: [168259]
   automated match to d1dsya_
   complexed with ca, co, edo, plp, so4

Details for d2uzpa_

PDB Entry: 2uzp, 2 Å

PDB Description: crystal structure of the c2 domain of human protein kinase c gamma.

PDB Compounds: (A:) protein kinase c gamma type

SCOPe Domain Sequences for d2uzpa_:

Sequence; same for both SEQRES and ATOM records:

>d2uzpa_ b.7.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smhterrgrlqleiraptadeihvtvgearnlipmdpnglsdpyvklklipdprnltkqk
trtvkatlnpvwnetfvfnlkpgdverrlsvevwdwdrtsrndfmgamsfgvsellkapv
dgwykllnqeegeyynvpvada

Timeline for d2uzpa_:

• d2uzpa_ first appeared in SCOPe 2.01
  
• d2uzpa_ appears in SCOPe 2.04
  
• d2uzpa_ appears in SCOPe 2.06
  
• d2uzpa_ appears in the current release, SCOPe 2.08