Lineage for d2uzfa_ (2uzf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100548Species Staphylococcus aureus [TaxId:1280] [187693] (2 PDB entries)
  8. 2100551Domain d2uzfa_: 2uzf A: [168255]
    automated match to d1rjnb_
    complexed with caa

Details for d2uzfa_

PDB Entry: 2uzf (more details), 2.9 Å

PDB Description: Crystal structure of Staphylococcus aureus 1,4-dihydroxy-2-naphthoyl CoA synthase (MenB) in complex with acetoacetyl CoA
PDB Compounds: (A:) naphthoate synthase

SCOPe Domain Sequences for d2uzfa_:

Sequence, based on SEQRES records: (download)

>d2uzfa_ c.14.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
wetlreydeikyefyegiakvtinrpevrnaftpktvaemidafsrarddqnvsvivltg
egdlafcsggdqkkrghggyvgedqiprlnvldlqrliriipkpviamvkgyavgggnvl
nvvcdltiaadnaifgqtgpkvgsfdagygsgylarivghkkareiwylcrqynaqeald
mglvntvvplekvedetvqwckeimkhsptalrflkaamnadtdglaglqqmagdatlly
yttdeakegrdafkekrdpdfdqfpkfp

Sequence, based on observed residues (ATOM records): (download)

>d2uzfa_ c.14.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
wetlreydeikyefyegiakvtinrpevrnaftpktvaemidafsrarddqnvsvivltg
egdlafcsggdqkgedqiprlnvldlqrliriipkpviamvkgyavgggnvlnvvcdlti
aadnaifgqtgpkvgsfdagygsgylarivghkkareiwylcrqynaqealdmglvntvv
plekvedetvqwckeimkhsptalrflkaamnadtdglaglqqmagdatllyyttdeake
grdafkekrdpdfdqfpkfp

SCOPe Domain Coordinates for d2uzfa_:

Click to download the PDB-style file with coordinates for d2uzfa_.
(The format of our PDB-style files is described here.)

Timeline for d2uzfa_: