Lineage for d2uz2a_ (2uz2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2806418Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2806419Protein automated matches [190537] (10 species)
    not a true protein
  7. 2806510Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [188454] (2 PDB entries)
  8. 2806513Domain d2uz2a_: 2uz2 A: [168252]
    automated match to d1rava_
    complexed with act, btn

Details for d2uz2a_

PDB Entry: 2uz2 (more details), 1.7 Å

PDB Description: crystal structure of xenavidin
PDB Compounds: (A:) xenavidin

SCOPe Domain Sequences for d2uz2a_:

Sequence, based on SEQRES records: (download)

>d2uz2a_ b.61.1.0 (A:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
qkcnlqgqwrnklgsnliiesvsqngeftgtyftsvsltnstirispltgyqkltekptf
gftvhwafsdsitvwtgqcflnekgeeilhtmwllrssqekeqdnwtgtrvgantftrl

Sequence, based on observed residues (ATOM records): (download)

>d2uz2a_ b.61.1.0 (A:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
qkcnlqgqwrnklgsnliiesvsqngeftgtyftsvslirispltgyqkltekptfgftv
hwafsdsitvwtgqcflnekgeeilhtmwllrssqekeqdnwtgtrvgantftrl

SCOPe Domain Coordinates for d2uz2a_:

Click to download the PDB-style file with coordinates for d2uz2a_.
(The format of our PDB-style files is described here.)

Timeline for d2uz2a_: