Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.0: automated matches [191402] (1 protein) not a true family |
Protein automated matches [190537] (10 species) not a true protein |
Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [188454] (2 PDB entries) |
Domain d2uz2a_: 2uz2 A: [168252] automated match to d1rava_ complexed with act, btn |
PDB Entry: 2uz2 (more details), 1.7 Å
SCOPe Domain Sequences for d2uz2a_:
Sequence, based on SEQRES records: (download)
>d2uz2a_ b.61.1.0 (A:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} qkcnlqgqwrnklgsnliiesvsqngeftgtyftsvsltnstirispltgyqkltekptf gftvhwafsdsitvwtgqcflnekgeeilhtmwllrssqekeqdnwtgtrvgantftrl
>d2uz2a_ b.61.1.0 (A:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]} qkcnlqgqwrnklgsnliiesvsqngeftgtyftsvslirispltgyqkltekptfgftv hwafsdsitvwtgqcflnekgeeilhtmwllrssqekeqdnwtgtrvgantftrl
Timeline for d2uz2a_: