Lineage for d2uywd_ (2uyw D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2397182Family b.61.1.0: automated matches [191402] (1 protein)
    not a true family
  6. 2397183Protein automated matches [190537] (8 species)
    not a true protein
  7. 2397246Species Western clawed frog (Xenopus tropicalis) [TaxId:8364] [188454] (2 PDB entries)
  8. 2397248Domain d2uywd_: 2uyw D: [168250]
    automated match to d1rava_
    complexed with btn, fmt

Details for d2uywd_

PDB Entry: 2uyw (more details), 1.7 Å

PDB Description: crystal structure of xenavidin
PDB Compounds: (D:) xenavidin

SCOPe Domain Sequences for d2uywd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uywd_ b.61.1.0 (D:) automated matches {Western clawed frog (Xenopus tropicalis) [TaxId: 8364]}
kcnlqgqwrnklgsnliiesvsqngeftgtyftsvsltnstirispltgyqkltekptfg
ftvhwafsdsitvwtgqcflnekgeeilhtmwllrssqekeqdnwtgtrvgantftrls

SCOPe Domain Coordinates for d2uywd_:

Click to download the PDB-style file with coordinates for d2uywd_.
(The format of our PDB-style files is described here.)

Timeline for d2uywd_: