Lineage for d1bgda_ (1bgd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705456Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 2705459Species Dog (Canis familiaris) [TaxId:9615] [47271] (2 PDB entries)
  8. 2705462Domain d1bgda_: 1bgd A: [16825]

Details for d1bgda_

PDB Entry: 1bgd (more details), 2.3 Å

PDB Description: crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)
PDB Compounds: (A:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d1bgda_:

Sequence, based on SEQRES records: (download)

>d1bgda_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]}
lpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssqa
lqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgmap
avpptqgtmpaftsafqrraggvlvasnlqsflelayralrhfa

Sequence, based on observed residues (ATOM records): (download)

>d1bgda_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]}
lpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssqa
lqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgmap
tmpaftsafqrraggvlvasnlqsflelayralrhfa

SCOPe Domain Coordinates for d1bgda_:

Click to download the PDB-style file with coordinates for d1bgda_.
(The format of our PDB-style files is described here.)

Timeline for d1bgda_: