Lineage for d2uyvb_ (2uyv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905490Fold c.74: AraD/HMP-PK domain-like [53638] (1 superfamily)
    3 layers: a/b/a; mixed (mostly antiparallel) beta-sheet of 9 strands, order 432159876; left-handed crossover between strands 4 and 5
  4. 2905491Superfamily c.74.1: AraD/HMP-PK domain-like [53639] (3 families) (S)
  5. 2905492Family c.74.1.1: AraD-like aldolase/epimerase [53640] (5 proteins)
    metal (zinc)-ion dependent
  6. 2905512Protein L-rhamnulose-1-phosphate aldolase [75301] (1 species)
  7. 2905513Species Escherichia coli [TaxId:562] [75302] (8 PDB entries)
  8. 2905527Domain d2uyvb_: 2uyv B: [168246]
    automated match to d1ojra_
    complexed with tla, zn; mutant

Details for d2uyvb_

PDB Entry: 2uyv (more details), 2.2 Å

PDB Description: l-rhamnulose-1-phosphate aldolase from escherichia coli (mutant q6y- e192a)
PDB Compounds: (B:) rhamnulose-1-phosphate aldolase

SCOPe Domain Sequences for d2uyvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uyvb_ c.74.1.1 (B:) L-rhamnulose-1-phosphate aldolase {Escherichia coli [TaxId: 562]}
mqnityswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
gilpwmvpgtdaigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
vysmggmkqtisreelialgkrfgvtplasalal

SCOPe Domain Coordinates for d2uyvb_:

Click to download the PDB-style file with coordinates for d2uyvb_.
(The format of our PDB-style files is described here.)

Timeline for d2uyvb_: