Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.151: DNase I-like [56218] (1 superfamily) contains beta-sandwich; duplication of alpha+beta motif |
Superfamily d.151.1: DNase I-like [56219] (4 families) |
Family d.151.1.3: Sphingomyelin phosphodiesterase-like [143902] (2 proteins) part of Pfam PF03372 |
Protein automated matches [190598] (1 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [187614] (4 PDB entries) |
Domain d2uyrx_: 2uyr X: [168242] automated match to d2ddra1 complexed with mg; mutant |
PDB Entry: 2uyr (more details), 2.4 Å
SCOPe Domain Sequences for d2uyrx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uyrx_ d.151.1.3 (X:) automated matches {Bacillus cereus [TaxId: 1396]} ndtlkvmthnvymlstnlypnwgqteradligaadyiknqdvvilnevfdasasdrllgn lkkeypnqtavlgrssgsewdktlgnyssstpedggvaivskwpiaekiqyvfakgcgpd nlsnkgfvytkikkndrfvhvigthlqaedsmcgktspasvrtnqlkeiqdfiknknipn neyvliggdmnvnkinaennndseyasmfktlnasvpsytghtatwdattnsiakynfpd spaeyldyiiaskdhanpsyienkvlqpkspqwtvtswfqkytyndysdhypveatism
Timeline for d2uyrx_: