Lineage for d2uynb_ (2uyn B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958620Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2958704Protein automated matches [190254] (5 species)
    not a true protein
  7. 2958713Species Escherichia coli [TaxId:562] [188034] (4 PDB entries)
  8. 2958718Domain d2uynb_: 2uyn B: [168237]
    automated match to d1qu9a_
    complexed with 2kt

Details for d2uynb_

PDB Entry: 2uyn (more details), 1.6 Å

PDB Description: crystal structure of e. coli tdcf with bound 2-ketobutyrate
PDB Compounds: (B:) protein tdcf

SCOPe Domain Sequences for d2uynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uynb_ d.79.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
kkiietqrapgaigpyvqgvdlgsmvftsgqipvcpqtgeipadvqdqarlslenvkaiv
vaaglsvgdiikmtvfitdlndfatinevykqffdehqatyptrscvqvarlpkdvklei
eaiavrs

SCOPe Domain Coordinates for d2uynb_:

Click to download the PDB-style file with coordinates for d2uynb_.
(The format of our PDB-style files is described here.)

Timeline for d2uynb_: