Lineage for d1bgea_ (1bge A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991436Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1991437Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1991438Family a.26.1.1: Long-chain cytokines [47267] (10 protein domains)
  6. 1991445Protein Granulocyte-colony stimulating factor (G-CSF) [47268] (3 species)
  7. 1991448Species Dog (Canis familiaris) [TaxId:9615] [47271] (2 PDB entries)
  8. 1991449Domain d1bgea_: 1bge A: [16823]

Details for d1bgea_

PDB Entry: 1bge (more details), 2.2 Å

PDB Description: crystal structure of canine and bovine granulocyte-colony stimulating factor (g-csf)
PDB Compounds: (A:) granulocyte colony-stimulating factor

SCOPe Domain Sequences for d1bgea_:

Sequence, based on SEQRES records: (download)

>d1bgea_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]}
plpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssq
alqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgma
pavpptqgtmpaftsafqrraggvlvasnlqsflelayralrhfak

Sequence, based on observed residues (ATOM records): (download)

>d1bgea_ a.26.1.1 (A:) Granulocyte-colony stimulating factor (G-CSF) {Dog (Canis familiaris) [TaxId: 9615]}
plpqsfllkcleqmrkvqadgtalqetlcathqlchpeelvllghalgipqpplsscssq
alqlmgclrqlhsglflyqgllqalagispelaptldtlqldttdfainiwqqmedlgma
ptmpaftsafqrraggvlvasnlqsflelayralrhfak

SCOPe Domain Coordinates for d1bgea_:

Click to download the PDB-style file with coordinates for d1bgea_.
(The format of our PDB-style files is described here.)

Timeline for d1bgea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bgeb_